Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FPGT protein

This Human FPGT protein spans the amino acid sequence from region 1-594aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FPGT

UniProt

O14772

Expression Region

1-594aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

68.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAARDPPEVSLREATQRKLRRFSELRGKLVARGEFWDIVAITAADEKQELAYNQQLSEKLKRKELPLGVQYHVFVDPAGAKIGNGGSTLCALQCLEKLYGDKWNSFTILLIHSGGYSQRLPNASALGKIFTALPLGNPIYQMLELKLAMYIDFPLNMNPGILVTCADDIELYSIGEFEFIRFDKPGFTALAHPSSLTIGTTHGVFVLDPFDDLKHRDLEYRSCHRFLHKPSIEKMYQFNAVCRPGNFCQQDFAGGDIADLKLDSDYVYTDSLFYMDHKSAKMLLAFYEKIGTLSCEIDAYGDFLQALGPGATVEYTRNTSNVIKEESELVEMRQRIFHLLKGTSLNVVVLNNSKFYHIGTTEEYLFYFTSDNSLKSELGLQSITFSIFPDIPECSGKTSCIIQSILDSRCSVAPGSVVEYSRLGPDVSVGENCIISGSYILTKAALPAHSFVCSLSLKMNRCLKYATMAFGVQDNLKKSVKTLSDIKLLQFFGVCFLSCLDVWNLKVTEELFSGNKTCLSLWTARIFPVCSSLSDSVITSLKMLNAVKNKSAFSLNSYKLLSIEEMLIYKDVEDMITYREQIFLEISLKSSLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal KIF2C Antibody (KIF2C/6518) [Janelia Fluor 646]
NBP3-20925JF646 0.1 mL

Mouse Monoclonal KIF2C Antibody (KIF2C/6518) [Janelia Fluor 646]

Sign In for Pricing
View Details
Ethyl 2- (3-ethoxy-5-methylphenyl) -2-oxoacetate
OR1091605-01 250 mg

Ethyl 2- (3-ethoxy-5-methylphenyl) -2-oxoacetate

Sign In for Pricing
View Details
Ethyl 2- (3-ethoxy-5-methylphenyl) -2-oxoacetate
OR1091605-02 500 mg

Ethyl 2- (3-ethoxy-5-methylphenyl) -2-oxoacetate

Sign In for Pricing
View Details
Ethyl 2- (3-ethoxy-5-methylphenyl) -2-oxoacetate
OR1091605-03 1 g

Ethyl 2- (3-ethoxy-5-methylphenyl) -2-oxoacetate

Sign In for Pricing
View Details
Ethyl 2- (3-ethoxy-5-methylphenyl) -2-oxoacetate
OR1091605-04 5 g

Ethyl 2- (3-ethoxy-5-methylphenyl) -2-oxoacetate

Sign In for Pricing
View Details
DDX39B Rabbit Monoclonal Antibody
E56G0310 100 µL

DDX39B Rabbit Monoclonal Antibody

Sign In for Pricing
View Details