Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FPGT protein

This Human FPGT protein spans the amino acid sequence from region 1-594aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FPGT

UniProt

O14772

Expression Region

1-594aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

68.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAARDPPEVSLREATQRKLRRFSELRGKLVARGEFWDIVAITAADEKQELAYNQQLSEKLKRKELPLGVQYHVFVDPAGAKIGNGGSTLCALQCLEKLYGDKWNSFTILLIHSGGYSQRLPNASALGKIFTALPLGNPIYQMLELKLAMYIDFPLNMNPGILVTCADDIELYSIGEFEFIRFDKPGFTALAHPSSLTIGTTHGVFVLDPFDDLKHRDLEYRSCHRFLHKPSIEKMYQFNAVCRPGNFCQQDFAGGDIADLKLDSDYVYTDSLFYMDHKSAKMLLAFYEKIGTLSCEIDAYGDFLQALGPGATVEYTRNTSNVIKEESELVEMRQRIFHLLKGTSLNVVVLNNSKFYHIGTTEEYLFYFTSDNSLKSELGLQSITFSIFPDIPECSGKTSCIIQSILDSRCSVAPGSVVEYSRLGPDVSVGENCIISGSYILTKAALPAHSFVCSLSLKMNRCLKYATMAFGVQDNLKKSVKTLSDIKLLQFFGVCFLSCLDVWNLKVTEELFSGNKTCLSLWTARIFPVCSSLSDSVITSLKMLNAVKNKSAFSLNSYKLLSIEEMLIYKDVEDMITYREQIFLEISLKSSLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TdT (DNTT) activation kit by CRISPRa
GA101246 1 Kit

Human TdT (DNTT) activation kit by CRISPRa

Sign In for Pricing
View Details
Hdac8 3'UTR Luciferase Stable Cell Line
TU109412 1.0 mL

Hdac8 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
KIBRA Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-11570R-BF680-TR 20 µL

KIBRA Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
P150 CAF1 Rabbit Polyclonal Antibody (BF594)
orb2376792 100 µL

P150 CAF1 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Drospirenone-d4 (2,2,19,19-d4)
CS-O-30461 1 Each

Drospirenone-d4 (2,2,19,19-d4)

Sign In for Pricing
View Details
CD21 (PE) discontinued
516280-01 20 Tests

CD21 (PE) discontinued

Sign In for Pricing
View Details