Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGFR3 protein

This Human FGFR3 protein spans the amino acid sequence from region 23-375aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FGFR3

UniProt

P22607

Expression Region

23-375aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Anti-Mouse IgG2c (heavy-chain sp.) -HRP Conjugate
40132 0.5 mL

Goat Anti-Mouse IgG2c (heavy-chain sp.) -HRP Conjugate

Sign In for Pricing
View Details
LAMB3 siRNA (Human)
CRH2653-01 15 nmol

LAMB3 siRNA (Human)

Sign In for Pricing
View Details
LAMB3 siRNA (Human)
CRH2653-02 30 nmol

LAMB3 siRNA (Human)

Sign In for Pricing
View Details
Human CD21 (Complement Receptor 2) ELISA Kit
EH0078 96 Tests

Human CD21 (Complement Receptor 2) ELISA Kit

Sign In for Pricing
View Details
SAR1B siRNA (Rat)
CRR3877-01 15 nmol

SAR1B siRNA (Rat)

Sign In for Pricing
View Details
SAR1B siRNA (Rat)
CRR3877-02 30 nmol

SAR1B siRNA (Rat)

Sign In for Pricing
View Details