Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FCGRT protein

This Human FCGRT protein spans the amino acid sequence from region 24-297aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha chain protein, Fc fragment of IgG, receptor transporter, alpha protein, FCGRT protein, FcRn alpha chain protein, FCRN protein, FCRN, alpha chain protein, IgG Fc fragment receptor transporter alpha chain protein, IgG Gc receptor protein, IgG receptor FcRn large subunit p51 protein, IgG receptor FcRn large subunit p51 precursor protein, Immunoglobulin receptor, intestinal, heavy chain protein, Neonatal Fc receptor protein, IgG R FcRn large subunit p51 protein

UniProt

P55899

Expression Region

24-297aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp574 Mouse Gene Knockout Kit (CRISPR)
KN519885 1 Kit

Zfp574 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant IRAKM Antibody
RC-15428-01 50 μL

Recombinant IRAKM Antibody

Sign In for Pricing
View Details
Recombinant IRAKM Antibody
RC-15428-02 100 µL

Recombinant IRAKM Antibody

Sign In for Pricing
View Details
Recombinant IRAKM Antibody
RC-15428-03 1 mL

Recombinant IRAKM Antibody

Sign In for Pricing
View Details
Orexin Receptor 1 (HCRTR1) Human Gene Knockout Kit (CRISPR)
KN210381BN 1 Kit

Orexin Receptor 1 (HCRTR1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ɑ-Butyric Acid-ω-Mercaptopropanamido PEG
1310000-4-32.500MG 500 mg

Ɑ-Butyric Acid-ω-Mercaptopropanamido PEG

Sign In for Pricing
View Details