Human FCGRT protein

Alpha chain protein, Fc fragment of IgG, receptor transporter, alpha protein, FCGRT protein, FcRn alpha chain protein, FCRN protein, FCRN, alpha chain protein, IgG Fc fragment receptor transporter alpha chain protein, IgG Gc receptor protein, IgG receptor FcRn large subunit p51 protein, IgG receptor FcRn large subunit p51 precursor protein, Immunoglobulin receptor, intestinal, heavy chain protein, Neonatal Fc receptor protein, IgG R FcRn large subunit p51 protein

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS