Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human 4E-BP2 protein

This Human 4E-BP2 protein spans the amino acid sequence from region 1-120aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Eukaryotic translation initiation factor 4E-binding protein 2 protein, 4E-BP2 protein, 4EBP2 protein, eIF4E-binding protein 2 protein, EIF4EBP2 protein

UniProt

Q13542

Expression Region

1-120aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL41P1 sgRNA CRISPR Lentivector set (Human)
K1994101 3x 1.0 µg

RPL41P1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
CD3 Mouse Monoclonal Antibody
AMM80514-01 1 Each

CD3 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD3 Mouse Monoclonal Antibody
AMM80514-02 50 µL

CD3 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD3 Mouse Monoclonal Antibody
AMM80514-03 100 µL

CD3 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
W/W016/NL327/TWM-297X420-1 Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)
236876 1 Pack (1 Panel (s) x 1 Pack)

W/W016/NL327/TWM-297X420-1 Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)

Sign In for Pricing
View Details
KRT13 Rabbit Polyclonal Antibody
E53P06598 100 µL

KRT13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details