Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EGR1 protein

This Human EGR1 protein spans the amino acid sequence from region 444-543aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EGR1

UniProt

P18146

Expression Region

444-543aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wdr63 sgRNA CRISPR Lentivector set (Rat)
K7186801 3x 1.0 µg

Wdr63 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
C3orf17 Polyclonal Antibody, HRP Conjugated
bs-9824R-HRP-TR 20 µL

C3orf17 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Asb5 (NM_001044247) Rat Tagged Lenti ORF Clone
RR201932L4 10 µg

Asb5 (NM_001044247) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GCN1L1 Protein Vector (Rat) (pPM-C-HA)
PV269856 500 ng

GCN1L1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Isovitexin 10mM * 1mL in DMSO
A12079-10mM-D 10 mM x 1mL in DMSO

Isovitexin 10mM * 1mL in DMSO

Sign In for Pricing
View Details
1-Methyl-2-nonylquinolin-4 (1H) -one
orb1683966-01 5 mg

1-Methyl-2-nonylquinolin-4 (1H) -one

Sign In for Pricing
View Details