Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EGR1 protein

This Human EGR1 protein spans the amino acid sequence from region 444-543aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EGR1

UniProt

P18146

Expression Region

444-543aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cellular Tumor Antigen p53 (TP53) Antibody
abx227079-01 40 µL

Cellular Tumor Antigen p53 (TP53) Antibody

Sign In for Pricing
View Details
Cellular Tumor Antigen p53 (TP53) Antibody
abx227079-02 100 µL

Cellular Tumor Antigen p53 (TP53) Antibody

Sign In for Pricing
View Details
Cellular Tumor Antigen p53 (TP53) Antibody
abx227079-03 200 µL

Cellular Tumor Antigen p53 (TP53) Antibody

Sign In for Pricing
View Details
Cellular Tumor Antigen p53 (TP53) Antibody
abx227079-04 500 µL

Cellular Tumor Antigen p53 (TP53) Antibody

Sign In for Pricing
View Details
Cellular Tumor Antigen p53 (TP53) Antibody
abx227079-05 1 mL

Cellular Tumor Antigen p53 (TP53) Antibody

Sign In for Pricing
View Details
MUC20 CRISPR Knock Out 293T Cell Line (Human)
31134141 1x 10^6 Cells / 1.0 mL

MUC20 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details