Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Efnb3 protein

This Mouse Efnb3 protein spans the amino acid sequence from region 28-227aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Efnb3

UniProt

O35393

Expression Region

28-227aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPSYEFYKLYLVEGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSAEPGRDTIPGDPSSNATSRGAEGPLPPPSMPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SLEV NS1/Non-structural protein 1 Protein, N-His
VK793012-01 50 µg

Recombinant SLEV NS1/Non-structural protein 1 Protein, N-His

Sign In for Pricing
View Details
Recombinant SLEV NS1/Non-structural protein 1 Protein, N-His
VK793012-02 100 µg

Recombinant SLEV NS1/Non-structural protein 1 Protein, N-His

Sign In for Pricing
View Details
Recombinant SLEV NS1/Non-structural protein 1 Protein, N-His
VK793012-03 1 mg

Recombinant SLEV NS1/Non-structural protein 1 Protein, N-His

Sign In for Pricing
View Details
GsiD Antibody
orb816935 2 mg

GsiD Antibody

Sign In for Pricing
View Details
Mouse Tissue Inhibitors of Metalloproteinase 4 (TIMP-4) ELISA Kit
orb1948897-01 48 Tests

Mouse Tissue Inhibitors of Metalloproteinase 4 (TIMP-4) ELISA Kit

Sign In for Pricing
View Details
Mouse Tissue Inhibitors of Metalloproteinase 4 (TIMP-4) ELISA Kit
orb1948897-02 96 Tests

Mouse Tissue Inhibitors of Metalloproteinase 4 (TIMP-4) ELISA Kit

Sign In for Pricing
View Details