Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Efna5 protein

This Rat Efna5 protein spans the amino acid sequence from region 21-203aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Efna5

UniProt

P97605

Expression Region

21-203aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDPGSKVVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVRDRVFDVNDKVENSLEPADDTVHESAEPSRGEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS6KA1 Antibody
CSB-PA121989-01 50 μL

RPS6KA1 Antibody

Sign In for Pricing
View Details
RPS6KA1 Antibody
CSB-PA121989-02 100 µL

RPS6KA1 Antibody

Sign In for Pricing
View Details
ZNF547 Rabbit Polyclonal Antibody (Cy7)
orb1084515 100 µL

ZNF547 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Canine Latrophilin 2 (LPHN2) ELISA Kit
MBS9938985-01 48 Well

Canine Latrophilin 2 (LPHN2) ELISA Kit

Sign In for Pricing
View Details
Canine Latrophilin 2 (LPHN2) ELISA Kit
MBS9938985-02 96 Well

Canine Latrophilin 2 (LPHN2) ELISA Kit

Sign In for Pricing
View Details
Canine Latrophilin 2 (LPHN2) ELISA Kit
MBS9938985-03 5x 96 Well

Canine Latrophilin 2 (LPHN2) ELISA Kit

Sign In for Pricing
View Details