Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Dcn protein

This Mouse Dcn protein spans the amino acid sequence from region 35-354aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dcn

UniProt

P28654

Expression Region

35-354aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Suv420h2 3'UTR Luciferase Stable Cell Line
TU119972 1.0 mL

Suv420h2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Chicken IL-3 (Interleukin 3) ELISA Kit
MBS2507634-01 24 Tests

Chicken IL-3 (Interleukin 3) ELISA Kit

Sign In for Pricing
View Details
Chicken IL-3 (Interleukin 3) ELISA Kit
MBS2507634-02 48 Tests

Chicken IL-3 (Interleukin 3) ELISA Kit

Sign In for Pricing
View Details
Chicken IL-3 (Interleukin 3) ELISA Kit
MBS2507634-03 96 Tests

Chicken IL-3 (Interleukin 3) ELISA Kit

Sign In for Pricing
View Details
Chicken IL-3 (Interleukin 3) ELISA Kit
MBS2507634-04 5x 96 Tests

Chicken IL-3 (Interleukin 3) ELISA Kit

Sign In for Pricing
View Details
Chicken IL-3 (Interleukin 3) ELISA Kit
MBS2507634-05 10x 96 Tests

Chicken IL-3 (Interleukin 3) ELISA Kit

Sign In for Pricing
View Details