Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CTSK protein

This Human CTSK protein spans the amino acid sequence from region 115-329aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CTSK CTSO, CTSO2

UniProt

P43235

Expression Region

115-329aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit for Immunoglobulin E (IgE)
TRV-0037813-01 24 Tests

ELISA Kit for Immunoglobulin E (IgE)

Sign In for Pricing
View Details
ELISA Kit for Immunoglobulin E (IgE)
TRV-0037813-02 48 Tests

ELISA Kit for Immunoglobulin E (IgE)

Sign In for Pricing
View Details
ELISA Kit for Immunoglobulin E (IgE)
TRV-0037813-03 96 Tests

ELISA Kit for Immunoglobulin E (IgE)

Sign In for Pricing
View Details
ELISA Kit for Immunoglobulin E (IgE)
TRV-0037813-04 5x 96 Tests

ELISA Kit for Immunoglobulin E (IgE)

Sign In for Pricing
View Details
ELISA Kit for Immunoglobulin E (IgE)
TRV-0037813-05 10x 96 Tests

ELISA Kit for Immunoglobulin E (IgE)

Sign In for Pricing
View Details
Nudt19 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3860104 1.0 µg DNA

Nudt19 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details