Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CTAG1A protein

This Human CTAG1A protein spans the amino acid sequence from region 1-180aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CTAG1A

UniProt

P78358

Expression Region

1-180aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFK Protein Vector (Rat) (pPM-C-HA)
38859026 500 ng

RFK Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
TOR2A Protein Vector (Rat) (pPB-N-His)
PV312371 500 ng

TOR2A Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Sulfite Oxidase, Mitochondrial (SUOX) Antibody
abx405791-01 100 µL

Sulfite Oxidase, Mitochondrial (SUOX) Antibody

Sign In for Pricing
View Details
Sulfite Oxidase, Mitochondrial (SUOX) Antibody
abx405791-02 200 µL

Sulfite Oxidase, Mitochondrial (SUOX) Antibody

Sign In for Pricing
View Details
Sulfite Oxidase, Mitochondrial (SUOX) Antibody
abx405791-03 1 mL

Sulfite Oxidase, Mitochondrial (SUOX) Antibody

Sign In for Pricing
View Details
2-Fluoro-3-hydroxy-4-methoxybenzoic acid
PC1023434 250 mg

2-Fluoro-3-hydroxy-4-methoxybenzoic acid

Sign In for Pricing
View Details