Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CRHR1 protein

This Human CRHR1 protein spans the amino acid sequence from region 23-121aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CRHR1

UniProt

P34998

Expression Region

23-121aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LEMD1 siRNA (h)
sc-88658 10 µM

LEMD1 siRNA (h)

Sign In for Pricing
View Details
RFC4 Protein Vector (Mouse) (pPB-C-His)
PV223614 500 ng

RFC4 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
KLK7 Rabbit Polyclonal Antibody (BF555)
orb2466972 100 µL

KLK7 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Mouse Crisp3 activation kit by CRISPRa
GA200114 1 Kit

Mouse Crisp3 activation kit by CRISPRa

Sign In for Pricing
View Details
Rat IgE (Immunoglobulin E) ELISA Kit
E-EL-R0517-01 24 Tests

Rat IgE (Immunoglobulin E) ELISA Kit

Sign In for Pricing
View Details
Rat IgE (Immunoglobulin E) ELISA Kit
E-EL-R0517-02 48 Tests

Rat IgE (Immunoglobulin E) ELISA Kit

Sign In for Pricing
View Details