Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CRHR1 protein

This Human CRHR1 protein spans the amino acid sequence from region 23-121aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CRHR1

UniProt

P34998

Expression Region

23-121aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc chloride
GE3236-5g 5 g

Fmoc chloride

Sign In for Pricing
View Details
MicroGripper Assembly; box of 20 assemblies
B-M7-A1-B5 20 Mounts/Base Assemblies

MicroGripper Assembly; box of 20 assemblies

Sign In for Pricing
View Details
Pla2g2e-set siRNA/shRNA/RNAi Lentivector (Mouse)
36908094 4x 500 ng

Pla2g2e-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Rabbit Anti-Duck IgG (H&L) - PE
CSA4755-01 100 µL

Rabbit Anti-Duck IgG (H&L) - PE

Sign In for Pricing
View Details
Rabbit Anti-Duck IgG (H&L) - PE
CSA4755-02 500 μL

Rabbit Anti-Duck IgG (H&L) - PE

Sign In for Pricing
View Details
Rabbit Anti-Duck IgG (H&L) - PE
CSA4755-03 1 mL

Rabbit Anti-Duck IgG (H&L) - PE

Sign In for Pricing
View Details