Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCL22 protein

This Human CCL22 protein spans the amino acid sequence from region 25-82aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

A 152E5.1 protein, ABCD 1 protein, C C motif chemokine 22 protein, CC chemokine STCP 1 protein, CC chemokine STCP-1 protein, ccl 22 protein, Ccl22 protein, CCL22_HUMAN protein, Chemokine (C C motif) ligand 22 protein, DCBCK protein, Macrophage-derived chemokine protein, MDC protein, Small inducible cytokine subfamily A member 22 protein, Small-inducible cytokine A22 protein, STCP 1 protein, Stimulated T cell chemotactic protein 1 protein

UniProt

O00626

Expression Region

25-82aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-conjugated Anti-CXCR3 antibody (DM208); Rabbit mAb
MBS1882732-01 100 Tests

PE-conjugated Anti-CXCR3 antibody (DM208); Rabbit mAb

Sign In for Pricing
View Details
PE-conjugated Anti-CXCR3 antibody (DM208); Rabbit mAb
MBS1882732-02 5x 100 Tests

PE-conjugated Anti-CXCR3 antibody (DM208); Rabbit mAb

Sign In for Pricing
View Details
Rat N-MID Osteocalcin ELISA Kit
MBS723175-01 48 Well

Rat N-MID Osteocalcin ELISA Kit

Sign In for Pricing
View Details
Rat N-MID Osteocalcin ELISA Kit
MBS723175-02 96 Well

Rat N-MID Osteocalcin ELISA Kit

Sign In for Pricing
View Details
Rat N-MID Osteocalcin ELISA Kit
MBS723175-03 5x 96 Well

Rat N-MID Osteocalcin ELISA Kit

Sign In for Pricing
View Details
Rat N-MID Osteocalcin ELISA Kit
MBS723175-04 10x 96 Well

Rat N-MID Osteocalcin ELISA Kit

Sign In for Pricing
View Details