Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Collagen I protein

This Collagen I protein spans the amino acid sequence from region 955-1207aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CO1A1_HUMAN proteins, Collagen I proteins, COL1A1 proteins, COL1A2 proteins, Collagen type I alpha 1 proteins, Collagen type I alpha 2 proteins

UniProt

P02454

Expression Region

955-1207aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGSPGAEGSPGRDGAPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKNGDRGETGPAGPAGPIGPAGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGSPGSPGEQGPSGASGPAGPRGPPGSAGSPGKDGLNGLPGPIGPPGPRGRTGDSGPAGPPGPPGPPGPPGPPSGGYDFSFLPQPPQEKSQDGGRYYRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1564776 Protein Vector (Rat) (pPM-C-HA)
PV300912 500 ng

RGD1564776 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
IL9R siRNA (Human)
CRH2395-01 15 nmol

IL9R siRNA (Human)

Sign In for Pricing
View Details
IL9R siRNA (Human)
CRH2395-02 30 nmol

IL9R siRNA (Human)

Sign In for Pricing
View Details
SMAD3-S208 Rabbit Polyclonal Antibody
E28PB4685 100 µL

SMAD3-S208 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SR 59230A HCl
MBS387823-01 10 mg

SR 59230A HCl

Sign In for Pricing
View Details
SR 59230A HCl
MBS387823-02 25 mg

SR 59230A HCl

Sign In for Pricing
View Details