Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CNKSR2 protein

This Human CNKSR2 protein spans the amino acid sequence from region 650-800aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CNKSR2

UniProt

Q8WXI2

Expression Region

650-800aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAEHLDDMNRWLNRINMLTAGYAERERIKQEQDYWSESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSCASPYVEAKHSRLSSTETSQSQSSHEEFRQEVTGSSAVSPIRKTASQRRSWQDLIETPLTSSGLHYLQTLPLEDSVFSDSAAI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TMPRSS11F Antibody
CTA5178-01 30 µL

Anti-TMPRSS11F Antibody

Sign In for Pricing
View Details
Anti-TMPRSS11F Antibody
CTA5178-02 50 μL

Anti-TMPRSS11F Antibody

Sign In for Pricing
View Details
Anti-TMPRSS11F Antibody
CTA5178-03 100 µL

Anti-TMPRSS11F Antibody

Sign In for Pricing
View Details
Anti-TMPRSS11F Antibody
CTA5178-04 200 µL

Anti-TMPRSS11F Antibody

Sign In for Pricing
View Details
Indole-3-carboxylic acid 500mg
A12338-500 500 mg

Indole-3-carboxylic acid 500mg

Sign In for Pricing
View Details
ALDOA Antibody (C-term)
E45G01796G-1 100 µL

ALDOA Antibody (C-term)

Sign In for Pricing
View Details