Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Chrna1 protein

This Mouse Chrna1 protein spans the amino acid sequence from region 21-230aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chrna1

UniProt

P04756

Expression Region

21-230aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Myofibroblast Marker Antibody (PR 2D3) [Alexa Fluor 750]
NBP2-50524AF750 0.1 mL

Mouse Monoclonal Myofibroblast Marker Antibody (PR 2D3) [Alexa Fluor 750]

Sign In for Pricing
View Details
OTX1 Rabbit Polyclonal Antibody (BF488)
orb2542793 100 µL

OTX1 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Phi29 DNA Polymerase (mutant)
HY-KE8011 125 U

Phi29 DNA Polymerase (mutant)

Sign In for Pricing
View Details
RG9MTD3 Antibody
GWB-MN709G 50 µg

RG9MTD3 Antibody

Sign In for Pricing
View Details
Monkey Muscarinic acetylcholine receptor M1 (CHRM1) ELISA kit
GTR10414698 96 Well

Monkey Muscarinic acetylcholine receptor M1 (CHRM1) ELISA kit

Sign In for Pricing
View Details
Mouse Double C2 Like Domains Beta (DOC2B) ELISA Kit
201-02-2106 96 Tests

Mouse Double C2 Like Domains Beta (DOC2B) ELISA Kit

Sign In for Pricing
View Details