Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PICK1 protein

This Human PICK1 protein spans the amino acid sequence from region 1-200aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PICK1

UniProt

Q9NRD5

Expression Region

1-200aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-EIF4A1/2/3 Antibody Picoband®, Carrier-free
A03922-2-carrier-free 100 µg/Vial

Anti-EIF4A1/2/3 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Recombinant Human Neuroligin 1/NLGN1 Protein (His Tag)
PKSH032798-01 10 µg

Recombinant Human Neuroligin 1/NLGN1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Neuroligin 1/NLGN1 Protein (His Tag)
PKSH032798-02 50 µg

Recombinant Human Neuroligin 1/NLGN1 Protein (His Tag)

Sign In for Pricing
View Details
GRIN2A Protein Vector (Rat) (pPM-C-His)
PV271561 500 ng

GRIN2A Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
IKBIP, CT (IKBIP, IKIP, Inhibitor of nuclear factor kappa-B kinase-interacting protein) (MaxLight 405) discontinued
036933-ML405 100 µL

IKBIP, CT (IKBIP, IKIP, Inhibitor of nuclear factor kappa-B kinase-interacting protein) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Bovine Single-stranded DNA-binding protein, mitochondrial, SSBP1 ELISA Kit
MBS9341330-01 48 Well

Bovine Single-stranded DNA-binding protein, mitochondrial, SSBP1 ELISA Kit

Sign In for Pricing
View Details