Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human C1D protein

This Human C1D protein spans the amino acid sequence from region 1-135aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C1D

UniProt

Q13901

Expression Region

1-135aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVAN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Species Probe-based qPCR Kit
MK1F48-01 25 Tests

Bovine Species Probe-based qPCR Kit

Sign In for Pricing
View Details
Bovine Species Probe-based qPCR Kit
MK1F48-02 48 Test

Bovine Species Probe-based qPCR Kit

Sign In for Pricing
View Details
Bovine Species Probe-based qPCR Kit
MK1F48-03 50 Tests

Bovine Species Probe-based qPCR Kit

Sign In for Pricing
View Details
Pcdhb12-set siRNA/shRNA/RNAi Lentivector (Rat)
36142096 4x 500 ng

Pcdhb12-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Recombinant Drosophila mojavensis Kinetochore protein Spc25 (Spc25)
MBS1057453-01 0.02 mg (E-Coli)

Recombinant Drosophila mojavensis Kinetochore protein Spc25 (Spc25)

Sign In for Pricing
View Details
Recombinant Drosophila mojavensis Kinetochore protein Spc25 (Spc25)
MBS1057453-02 0.1 mg (E-Coli)

Recombinant Drosophila mojavensis Kinetochore protein Spc25 (Spc25)

Sign In for Pricing
View Details