Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human C1D protein

This Human C1D protein spans the amino acid sequence from region 1-135aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C1D

UniProt

Q13901

Expression Region

1-135aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVAN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Claudin 18 monoclonal antibody
orb1495377-01 50 μL

Claudin 18 monoclonal antibody

Sign In for Pricing
View Details
Claudin 18 monoclonal antibody
orb1495377-02 100 µL

Claudin 18 monoclonal antibody

Sign In for Pricing
View Details
Claudin 18 monoclonal antibody
orb1495377-03 200 µL

Claudin 18 monoclonal antibody

Sign In for Pricing
View Details
SPAC3A11.07 Antibody
orb855174 2 mg

SPAC3A11.07 Antibody

Sign In for Pricing
View Details
SCN-10-BLACK ClipSleeve Markers
313147 300 Pack (30 Sleeve (s) x 10 Wand)

SCN-10-BLACK ClipSleeve Markers

Sign In for Pricing
View Details
Clipin A Rabbit Polyclonal Antibody
orb318776-01 30 µL

Clipin A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details