Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RPL10A protein

This Human RPL10A protein spans the amino acid sequence from region 4-215aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RPL10A NEDD6

UniProt

P62906

Expression Region

4-215aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKPQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Decorin, Recombinant, Mouse, aa35-35, His-SUMO-Tag (Dcn)
373016-01 20 µg

Decorin, Recombinant, Mouse, aa35-35, His-SUMO-Tag (Dcn)

Sign In for Pricing
View Details
Decorin, Recombinant, Mouse, aa35-35, His-SUMO-Tag (Dcn)
373016-02 100 µg

Decorin, Recombinant, Mouse, aa35-35, His-SUMO-Tag (Dcn)

Sign In for Pricing
View Details
Response gene to complement 32 protein
orb1637217-01 50 µg

Response gene to complement 32 protein

Sign In for Pricing
View Details
Response gene to complement 32 protein
orb1637217-02 100 µg

Response gene to complement 32 protein

Sign In for Pricing
View Details
Response gene to complement 32 protein
orb1637217-03 1 mg

Response gene to complement 32 protein

Sign In for Pricing
View Details
HAVCR1 Rabbit Polyclonal Antibody (AP)
orb966657 100 µL

HAVCR1 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details