Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SCAMP3 protein

This Human SCAMP3 protein spans the amino acid sequence from region 2-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SCAMP3 C1orf3, PROPIN1

UniProt

O14828

Expression Region

2-170aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KCNA4 (Potassium voltage-gated channel subfamily A member 4) ELISA Kit
MBS7606074-01 48 Well

Human KCNA4 (Potassium voltage-gated channel subfamily A member 4) ELISA Kit

Sign In for Pricing
View Details
Human KCNA4 (Potassium voltage-gated channel subfamily A member 4) ELISA Kit
MBS7606074-02 96 Well

Human KCNA4 (Potassium voltage-gated channel subfamily A member 4) ELISA Kit

Sign In for Pricing
View Details
Human KCNA4 (Potassium voltage-gated channel subfamily A member 4) ELISA Kit
MBS7606074-03 5x 96 Well

Human KCNA4 (Potassium voltage-gated channel subfamily A member 4) ELISA Kit

Sign In for Pricing
View Details
Human KCNA4 (Potassium voltage-gated channel subfamily A member 4) ELISA Kit
MBS7606074-04 10x 96 Well

Human KCNA4 (Potassium voltage-gated channel subfamily A member 4) ELISA Kit

Sign In for Pricing
View Details
Human Cytovillin CVL ELISA Kit
BG-HUM10535 1 Each

Human Cytovillin CVL ELISA Kit

Sign In for Pricing
View Details
Topoisomerase II Immunofluorescence Kit
TOP-TG1030 1 Kit

Topoisomerase II Immunofluorescence Kit

Sign In for Pricing
View Details