Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ARPC3 protein

This Human ARPC3 protein spans the amino acid sequence from region 2-175aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ARPC3 ARC21

UniProt

O15145

Expression Region

2-175aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEMA5A Polyclonal Conjugated Antibody
MBS9440312-01 0.1 mL (Biotin)

SEMA5A Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
SEMA5A Polyclonal Conjugated Antibody
MBS9440312-02 0.1 mL (AF350)

SEMA5A Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
SEMA5A Polyclonal Conjugated Antibody
MBS9440312-03 0.1 mL (AF405)

SEMA5A Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
SEMA5A Polyclonal Conjugated Antibody
MBS9440312-04 0.1 mL (AF488)

SEMA5A Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
SEMA5A Polyclonal Conjugated Antibody
MBS9440312-05 0.1 mL (AF555)

SEMA5A Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
SEMA5A Polyclonal Conjugated Antibody
MBS9440312-06 0.1 mL (AF594)

SEMA5A Polyclonal Conjugated Antibody

Sign In for Pricing
View Details