Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MYL6 protein

This Human MYL6 protein spans the amino acid sequence from region 3-151aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MYL6

UniProt

P60660

Expression Region

3-151aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIE1 Polyclonal Antibody
bs-1334R-01 20 µL

TIE1 Polyclonal Antibody

Sign In for Pricing
View Details
TIE1 Polyclonal Antibody
bs-1334R-02 100 µL

TIE1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human NFATC3
MBS7613615-01 0.05 mg

Recombinant Human NFATC3

Sign In for Pricing
View Details
Recombinant Human NFATC3
MBS7613615-02 0.2 mg

Recombinant Human NFATC3

Sign In for Pricing
View Details
Recombinant Human NFATC3
MBS7613615-03 1 mg

Recombinant Human NFATC3

Sign In for Pricing
View Details
Recombinant Human NFATC3
MBS7613615-04 5x 1 mg

Recombinant Human NFATC3

Sign In for Pricing
View Details