Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NDUFA2 protein

This Human NDUFA2 protein spans the amino acid sequence from region 4-99aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NDUFA2

UniProt

O43678

Expression Region

4-99aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transcription factor 25 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2374893 100 µL

Transcription factor 25 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Gastric Inhibitory Polypeptide Receptor (GIPR, GC126722, HGNC:4271, GIP-R)
G2018-11 100 µg

Gastric Inhibitory Polypeptide Receptor (GIPR, GC126722, HGNC:4271, GIP-R)

Sign In for Pricing
View Details
Lentiviral human PPIL2 sgRNA gene knockout kit - Lentiviral human PPIL2 sgRNA gene knockout kit (100)
GTR15361060 1 Vial

Lentiviral human PPIL2 sgRNA gene knockout kit - Lentiviral human PPIL2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
9- (2-Chloro-ethyl) -9H-purin-6-ylamine
C4980-74 1 g

9- (2-Chloro-ethyl) -9H-purin-6-ylamine

Sign In for Pricing
View Details
RAD21 3'UTR Luciferase Stable Cell Line
TU019436 1.0 mL

RAD21 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TFG, ID (TFG, Protein TFG, TRK-fused gene protein) (MaxLight 750)
MBS6355094-01 0.1 mL

TFG, ID (TFG, Protein TFG, TRK-fused gene protein) (MaxLight 750)

Sign In for Pricing
View Details