Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SLC20A3 protein

This Human SLC20A3 protein spans the amino acid sequence from region 47-87aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SLC20A3

UniProt

P53007

Expression Region

47-87aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Lysozyme,LZM;LSZ ELISA KIT
JOT-EK0325Hu-01 48 Well

Human Lysozyme,LZM;LSZ ELISA KIT

Sign In for Pricing
View Details
Human Lysozyme,LZM;LSZ ELISA KIT
JOT-EK0325Hu-02 96 Well

Human Lysozyme,LZM;LSZ ELISA KIT

Sign In for Pricing
View Details
C1orf133 Protein Vector (Human) (pPB-His-GST)
PV329859 500 ng

C1orf133 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
DCUN1D2 Antibody (Biotin)
orb32948-01 50 µg

DCUN1D2 Antibody (Biotin)

Sign In for Pricing
View Details
DCUN1D2 Antibody (Biotin)
orb32948-02 100 µg

DCUN1D2 Antibody (Biotin)

Sign In for Pricing
View Details
MCM8 Rabbit Polyclonal Antibody (Biotin)
orb2131484 100 µL

MCM8 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details