Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SLC20A3 protein

This Human SLC20A3 protein spans the amino acid sequence from region 47-87aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SLC20A3

UniProt

P53007

Expression Region

47-87aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse circovirus type 2 antibody (CV-2 Ab) ELISA Kit
YP-W20889-01 48 Tests

Mouse circovirus type 2 antibody (CV-2 Ab) ELISA Kit

Sign In for Pricing
View Details
Mouse circovirus type 2 antibody (CV-2 Ab) ELISA Kit
YP-W20889-02 96 Tests

Mouse circovirus type 2 antibody (CV-2 Ab) ELISA Kit

Sign In for Pricing
View Details
GNAS Antibody
orb518924-01 50 μL

GNAS Antibody

Sign In for Pricing
View Details
GNAS Antibody
orb518924-02 100 µL

GNAS Antibody

Sign In for Pricing
View Details
Pancreatic alpha amylase (AMY2A) (NM_000699) Human Over-expression Lysate
LS000279-20ug 20 µg

Pancreatic alpha amylase (AMY2A) (NM_000699) Human Over-expression Lysate

Sign In for Pricing
View Details
RNA-binding protein 7 (RBM7) Human ELISA Kit
G8344 96 Tests

RNA-binding protein 7 (RBM7) Human ELISA Kit

Sign In for Pricing
View Details