Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MRPL9 protein

This Human MRPL9 protein spans the amino acid sequence from region 60-267aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MRPL9

UniProt

Q9BYD2

Expression Region

60-267aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

WKVPLAGEGRKPRLHRRHRVYKLVEDTKHRPKENLELILTQSVENVGVRGDLVSVKKSLGRNRLLPQGLAVYASPENKKLFEEEKLLRQEGKLEKIQTKAGEATVKFLKSCRLEVGMKNNVKWELNPEIVARHFFKNLGVVVAPHTLKLPEEPITRWGEYWCEVTVNGLDTVRVPMSVVNFEKPKTKRYKYWLAQQAAKAMAPTSPQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Methoxy-α- (1-methylethyl) -4-pyridinemethanol
OR1088724-01 250 mg

2-Methoxy-α- (1-methylethyl) -4-pyridinemethanol

Sign In for Pricing
View Details
2-Methoxy-α- (1-methylethyl) -4-pyridinemethanol
OR1088724-02 500 mg

2-Methoxy-α- (1-methylethyl) -4-pyridinemethanol

Sign In for Pricing
View Details
Olfr1126 3'UTR Luciferase Stable Cell Line
TU114648 1.0 mL

Olfr1126 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ZMYM4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV704530 1.0 µg DNA

ZMYM4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
IL15RA Rabbit Polyclonal Antibody (FITC)
orb461387 100 µL

IL15RA Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Phospho-Nanog (S71) Antibody
E45R05219G-1 100 µL

Phospho-Nanog (S71) Antibody

Sign In for Pricing
View Details