Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GP25L2 protein

This Human GP25L2 protein spans the amino acid sequence from region 40-197aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GP25L2

UniProt

Q9BVK6

Expression Region

40-197aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MFAP2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV649549 1.0 µg DNA

MFAP2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human TMEM63C knockdown cell line
ABC-KD15747 1 Vial

Human TMEM63C knockdown cell line

Sign In for Pricing
View Details
UBA52 Antibody, HRP conjugated
MBS7105930-01 0.05 mg

UBA52 Antibody, HRP conjugated

Sign In for Pricing
View Details
UBA52 Antibody, HRP conjugated
MBS7105930-02 0.1 mg

UBA52 Antibody, HRP conjugated

Sign In for Pricing
View Details
UBA52 Antibody, HRP conjugated
MBS7105930-03 5x 0.1 mg

UBA52 Antibody, HRP conjugated

Sign In for Pricing
View Details
Anti-c-RET Antibody (Regeneron patent anti-RET)
F1573-.1 100 µg

Anti-c-RET Antibody (Regeneron patent anti-RET)

Sign In for Pricing
View Details