Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BC2 protein

This Human BC2 protein spans the amino acid sequence from region 1-222aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BC2, CHMP2, CHMP2A

UniProt

O43633

Expression Region

1-222aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics, Infectious Diseases

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLRRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHF1 Antibody
CSB-PA063428 100 µL

PHF1 Antibody

Sign In for Pricing
View Details
Anti-PKCθ (N-terminal region) Antibody
PM2171 100 µL

Anti-PKCθ (N-terminal region) Antibody

Sign In for Pricing
View Details
FOXA2 (HNF3B, TCF3B, Forkhead box A2, OTTHUMP00000030409, MGC19807, OTTHUMP00000030410, Hepatic Nuclear Factor-3-beta, Hepatocyte Nuclear Factor 3, beta) (MaxLight 490)
MBS6204800-01 0.1 mL

FOXA2 (HNF3B, TCF3B, Forkhead box A2, OTTHUMP00000030409, MGC19807, OTTHUMP00000030410, Hepatic Nuclear Factor-3-beta, Hepatocyte Nuclear Factor 3, beta) (MaxLight 490)

Sign In for Pricing
View Details
FOXA2 (HNF3B, TCF3B, Forkhead box A2, OTTHUMP00000030409, MGC19807, OTTHUMP00000030410, Hepatic Nuclear Factor-3-beta, Hepatocyte Nuclear Factor 3, beta) (MaxLight 490)
MBS6204800-02 5x 0.1 mL

FOXA2 (HNF3B, TCF3B, Forkhead box A2, OTTHUMP00000030409, MGC19807, OTTHUMP00000030410, Hepatic Nuclear Factor-3-beta, Hepatocyte Nuclear Factor 3, beta) (MaxLight 490)

Sign In for Pricing
View Details
Hsa-miR-519a-3p miRNA Inhibitor
CIH0299-01 10 nmol

Hsa-miR-519a-3p miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-519a-3p miRNA Inhibitor
CIH0299-02 20 nmol

Hsa-miR-519a-3p miRNA Inhibitor

Sign In for Pricing
View Details