Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BC2 protein

This Human BC2 protein spans the amino acid sequence from region 1-222aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BC2, CHMP2, CHMP2A

UniProt

O43633

Expression Region

1-222aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics, Infectious Diseases

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLRRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEPPS Buffer 0.2M, pH 8.0
NBB-2096-01 100 mL

HEPPS Buffer 0.2M, pH 8.0

Sign In for Pricing
View Details
HEPPS Buffer 0.2M, pH 8.0
NBB-2096-02 250 mL

HEPPS Buffer 0.2M, pH 8.0

Sign In for Pricing
View Details
ARMX3 Conjugated Antibody
orb1623532 100 µL

ARMX3 Conjugated Antibody

Sign In for Pricing
View Details
Acp2 3'UTR Luciferase Stable Cell Line
TU200181 1.0 mL

Acp2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lentiviral human SNAP25 shRNA (UAS) - Lentiviral human SNAP25 shRNA (UAS, RFP) plasmid
GTR15089029 1 Vial

Lentiviral human SNAP25 shRNA (UAS) - Lentiviral human SNAP25 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Mafa Polyclonal Antibody Bio Conjugated
orb1541378 100 µL

Mafa Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details