Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BC2 protein

This Human BC2 protein spans the amino acid sequence from region 1-222aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BC2, CHMP2, CHMP2A

UniProt

O43633

Expression Region

1-222aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics, Infectious Diseases

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLRRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spink10 Protein Vector (Mouse) (pPM-C-HA)
PV233380 500 ng

Spink10 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
2.0 mL conical base screw cap microcentrifuge tube, graduated, natural with red cap, 500/pack
1420-8704 500/PCK

2.0 mL conical base screw cap microcentrifuge tube, graduated, natural with red cap, 500/pack

Sign In for Pricing
View Details
Cystatin C (Human) BioAssayTM ELISA Kit
471956 96 Tests

Cystatin C (Human) BioAssayTM ELISA Kit

Sign In for Pricing
View Details
Recombinant Ehrlichia ruminantium Biotin synthase (bioB)
MBS1476699-01 0.02 mg (E-Coli)

Recombinant Ehrlichia ruminantium Biotin synthase (bioB)

Sign In for Pricing
View Details
Recombinant Ehrlichia ruminantium Biotin synthase (bioB)
MBS1476699-02 0.02 mg (Yeast)

Recombinant Ehrlichia ruminantium Biotin synthase (bioB)

Sign In for Pricing
View Details
Recombinant Ehrlichia ruminantium Biotin synthase (bioB)
MBS1476699-03 0.1 mg (E-Coli)

Recombinant Ehrlichia ruminantium Biotin synthase (bioB)

Sign In for Pricing
View Details