Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NDUFS5 protein

This Human NDUFS5 protein spans the amino acid sequence from region 2-106aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NDUFS5

UniProt

O43920

Expression Region

2-106aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NADH-Ubiquinone Oxidoreductase Chain 5 (MT-ND5) ELISA Kit
MBS9715150-01 48 Tests

Human NADH-Ubiquinone Oxidoreductase Chain 5 (MT-ND5) ELISA Kit

Sign In for Pricing
View Details
Human NADH-Ubiquinone Oxidoreductase Chain 5 (MT-ND5) ELISA Kit
MBS9715150-02 96 Tests

Human NADH-Ubiquinone Oxidoreductase Chain 5 (MT-ND5) ELISA Kit

Sign In for Pricing
View Details
Human NADH-Ubiquinone Oxidoreductase Chain 5 (MT-ND5) ELISA Kit
MBS9715150-03 5x 96 Tests

Human NADH-Ubiquinone Oxidoreductase Chain 5 (MT-ND5) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal MN1 Antibody [DyLight 350]
NBP3-06351UV 0.1 mL

Rabbit Polyclonal MN1 Antibody [DyLight 350]

Sign In for Pricing
View Details
Rabbit Polyclonal SHBG Antibody
NBP2-41294-0.025mg 0.025 mg

Rabbit Polyclonal SHBG Antibody

Sign In for Pricing
View Details
Xirp1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
50519114 3x 1.0 µg

Xirp1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details