Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NDUFS5 protein

This Human NDUFS5 protein spans the amino acid sequence from region 2-106aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NDUFS5

UniProt

O43920

Expression Region

2-106aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Nitrobenezenesulfonic acid sodium salt
284944-01 25 g

3-Nitrobenezenesulfonic acid sodium salt

Sign In for Pricing
View Details
3-Nitrobenezenesulfonic acid sodium salt
284944-02 50 g

3-Nitrobenezenesulfonic acid sodium salt

Sign In for Pricing
View Details
3-Nitrobenezenesulfonic acid sodium salt
284944-03 100 g

3-Nitrobenezenesulfonic acid sodium salt

Sign In for Pricing
View Details
3-Nitrobenezenesulfonic acid sodium salt
284944-04 250 g

3-Nitrobenezenesulfonic acid sodium salt

Sign In for Pricing
View Details
3-Nitrobenezenesulfonic acid sodium salt
284944-05 500 g

3-Nitrobenezenesulfonic acid sodium salt

Sign In for Pricing
View Details
CD8A Antibody (N-term)
E45R31205G-4 50 µL

CD8A Antibody (N-term)

Sign In for Pricing
View Details