Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TAX1BP3 protein

This Human TAX1BP3 protein spans the amino acid sequence from region 1-124aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TAX1BP3

UniProt

O14907

Expression Region

1-124aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant MBD3 Antibody
RC-15799-01 50 μL

Recombinant MBD3 Antibody

Sign In for Pricing
View Details
Recombinant MBD3 Antibody
RC-15799-02 100 µL

Recombinant MBD3 Antibody

Sign In for Pricing
View Details
Recombinant MBD3 Antibody
RC-15799-03 1 mL

Recombinant MBD3 Antibody

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]
E-AB-F1131UI-01 25 µg

PE/Cyanine5.5 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]
E-AB-F1131UI-02 100 µg

PE/Cyanine5.5 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/1467), Biotin conjugate, 0.1mg/mL
BNCB1467-500 1x 500 µL

MCM7 (Proliferation Marker) (MCM7/1467), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details