Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KIAA0024 protein

This Human KIAA0024 protein spans the amino acid sequence from region 1-35aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

KIAA0024, PSSA

UniProt

P48651

Expression Region

1-35aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TRIB1 Antibody (OTI8C8) [Alexa Fluor 532]
NBP2-74596AF532 0.1 mL

Mouse Monoclonal TRIB1 Antibody (OTI8C8) [Alexa Fluor 532]

Sign In for Pricing
View Details
HSD11B1 siRNA (Mouse)
CRM1928-01 15 nmol

HSD11B1 siRNA (Mouse)

Sign In for Pricing
View Details
HSD11B1 siRNA (Mouse)
CRM1928-02 30 nmol

HSD11B1 siRNA (Mouse)

Sign In for Pricing
View Details
Lentiviral human UBXN7 shRNA (UAS) - Lentiviral human UBXN7 shRNA (UAS, RFP) (25)
GTR15079103 1 Vial

Lentiviral human UBXN7 shRNA (UAS) - Lentiviral human UBXN7 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Recombinant Nostoc sp. DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1287738-01 0.02 mg (E-Coli)

Recombinant Nostoc sp. DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Nostoc sp. DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1287738-02 0.1 mg (E-Coli)

Recombinant Nostoc sp. DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details