Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AFG3L2 protein

This Human AFG3L2 protein spans the amino acid sequence from region 550-759aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AFG3L2

UniProt

Q9Y4W6

Expression Region

550-759aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWYLEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITTGAQDDLRKVTQSAYAQIVQFGMNEKVGQISFDLPRQGDMVLEKPYSEATARLIDDEVRILINDAYKRTVALLTEKKADVEKVALLLLEKEVLDKNDMVELLGPRPFAEKSTYEEF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-U6-ICMT-shRNA1-Puro Plasmid
PVT65955 2 µg

PLV3-U6-ICMT-shRNA1-Puro Plasmid

Sign In for Pricing
View Details
2-Aminophenyl 2,3,4-tri-O-acetyl-b-D-glucuronide methyl ester
292333-01 50 mg

2-Aminophenyl 2,3,4-tri-O-acetyl-b-D-glucuronide methyl ester

Sign In for Pricing
View Details
2-Aminophenyl 2,3,4-tri-O-acetyl-b-D-glucuronide methyl ester
292333-02 100 mg

2-Aminophenyl 2,3,4-tri-O-acetyl-b-D-glucuronide methyl ester

Sign In for Pricing
View Details
2-Aminophenyl 2,3,4-tri-O-acetyl-b-D-glucuronide methyl ester
292333-03 250 mg

2-Aminophenyl 2,3,4-tri-O-acetyl-b-D-glucuronide methyl ester

Sign In for Pricing
View Details
2-Aminophenyl 2,3,4-tri-O-acetyl-b-D-glucuronide methyl ester
292333-04 500 mg

2-Aminophenyl 2,3,4-tri-O-acetyl-b-D-glucuronide methyl ester

Sign In for Pricing
View Details
2-Aminophenyl 2,3,4-tri-O-acetyl-b-D-glucuronide methyl ester
292333-05 1 g

2-Aminophenyl 2,3,4-tri-O-acetyl-b-D-glucuronide methyl ester

Sign In for Pricing
View Details