Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HCGV protein

This Human HCGV protein spans the amino acid sequence from region 1-126aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HCGV, TCTE5

UniProt

O60927

Expression Region

1-126aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAFGESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CXCL3/GRO gamma Protein (His Tag)
PKSH032300-01 20 µg

Recombinant Human CXCL3/GRO gamma Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CXCL3/GRO gamma Protein (His Tag)
PKSH032300-02 100 µg

Recombinant Human CXCL3/GRO gamma Protein (His Tag)

Sign In for Pricing
View Details
2-Hydroxy-3-(4-(4-hydroxy-3,5-diiodophenoxy)-3,5-dinitrophenyl)propanoic acid
TRC-H942968-250MG 250 mg

2-Hydroxy-3-(4-(4-hydroxy-3,5-diiodophenoxy)-3,5-dinitrophenyl)propanoic acid

Sign In for Pricing
View Details
CD99 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H5]
TA800924BM 100 µL

CD99 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H5]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Abrus precatorius Lectin (Jequirity Bean) -APA-,  30nm
GP-4001-30 1 mL

Colloidal Gold Conjugated Abrus precatorius Lectin (Jequirity Bean) -APA-, 30nm

Sign In for Pricing
View Details
BMAL1 (ARNTL) (NM_001178) Human Over-expression Lysate
LC400474 20 µg

BMAL1 (ARNTL) (NM_001178) Human Over-expression Lysate

Sign In for Pricing
View Details