Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HCGV protein

This Human HCGV protein spans the amino acid sequence from region 1-126aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HCGV, TCTE5

UniProt

O60927

Expression Region

1-126aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAFGESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPM1B (NM_002706) Human Recombinant Protein
TP312918L 1 mg

PPM1B (NM_002706) Human Recombinant Protein

Sign In for Pricing
View Details
COPS3 Rabbit Polyclonal Antibody
TA366268 100 µL

COPS3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Magnetic Stirrer, 7x7 inch, 115V
H3770-S 1 Each

Magnetic Stirrer, 7x7 inch, 115V

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2641), 0.2mg/mL
BNUB2641-100 1x 100 µL

Prolactin (Pituitary Tumor Marker) (PRL/2641), 0.2mg/mL

Sign In for Pricing
View Details
ASS1 Rabbit Polyclonal Antibody
R1608-5 100 µL

ASS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DEFB119 Human qPCR Primer Pair (NM_153289)
HP218103 200 Reactions

DEFB119 Human qPCR Primer Pair (NM_153289)

Sign In for Pricing
View Details