Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HCGV protein

This Human HCGV protein spans the amino acid sequence from region 1-126aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HCGV, TCTE5

UniProt

O60927

Expression Region

1-126aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAFGESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-BRAT1 Rabbit Monoclonal Antibody
M06265-1-100μl 100 µL

Anti-BRAT1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Phospho-ATG9A (Ser735) Rabbit Polyclonal Antibody (BF680)
orb2412846 100 µL

Phospho-ATG9A (Ser735) Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Mouse Carboxypeptidase E ELISA Kit
orb1473389 96 Tests

Mouse Carboxypeptidase E ELISA Kit

Sign In for Pricing
View Details
TSC1, Phosphorylated (S594) (Tsc1, Kiaa0243, Hamartin, Tuberous sclerosis 1 protein homolog) (AP)
MBS6359078-01 0.2 mL

TSC1, Phosphorylated (S594) (Tsc1, Kiaa0243, Hamartin, Tuberous sclerosis 1 protein homolog) (AP)

Sign In for Pricing
View Details
TSC1, Phosphorylated (S594) (Tsc1, Kiaa0243, Hamartin, Tuberous sclerosis 1 protein homolog) (AP)
MBS6359078-02 5x 0.2 mL

TSC1, Phosphorylated (S594) (Tsc1, Kiaa0243, Hamartin, Tuberous sclerosis 1 protein homolog) (AP)

Sign In for Pricing
View Details
ZC3H12B Human Over-expression Lysate
orb1342607 100 µg

ZC3H12B Human Over-expression Lysate

Sign In for Pricing
View Details