Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human UQCR protein

This Human UQCR protein spans the amino acid sequence from region 1-56aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UQCR, UQCR11

UniProt

O14957

Expression Region

1-56aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Arylsulfatase K ARSK Antibody
A13400-2 100 µL

Anti-Arylsulfatase K ARSK Antibody

Sign In for Pricing
View Details
FKBP11, NT (FK506-binding Protein 11, Peptidyl-prolyl cis-trans Isomerase FKBP11, PPIase FKBP11, Rotamase, 19kD FK506-binding Protein, 19kD FKBP, FKBP-19, UNQ336/PRO535, FKBP19, FKBP-11) (MaxLight 650)
MBS6476074-01 0.1 mL

FKBP11, NT (FK506-binding Protein 11, Peptidyl-prolyl cis-trans Isomerase FKBP11, PPIase FKBP11, Rotamase, 19kD FK506-binding Protein, 19kD FKBP, FKBP-19, UNQ336/PRO535, FKBP19, FKBP-11) (MaxLight 650)

Sign In for Pricing
View Details
FKBP11, NT (FK506-binding Protein 11, Peptidyl-prolyl cis-trans Isomerase FKBP11, PPIase FKBP11, Rotamase, 19kD FK506-binding Protein, 19kD FKBP, FKBP-19, UNQ336/PRO535, FKBP19, FKBP-11) (MaxLight 650)
MBS6476074-02 5x 0.1 mL

FKBP11, NT (FK506-binding Protein 11, Peptidyl-prolyl cis-trans Isomerase FKBP11, PPIase FKBP11, Rotamase, 19kD FK506-binding Protein, 19kD FKBP, FKBP-19, UNQ336/PRO535, FKBP19, FKBP-11) (MaxLight 650)

Sign In for Pricing
View Details
AffiniPure Rabbit Anti-Rat IgG (H+L) secondary antibody, DyLight488 Conjugated
MBS1759568-01 0.5 mL

AffiniPure Rabbit Anti-Rat IgG (H+L) secondary antibody, DyLight488 Conjugated

Sign In for Pricing
View Details
AffiniPure Rabbit Anti-Rat IgG (H+L) secondary antibody, DyLight488 Conjugated
MBS1759568-02 1 mL

AffiniPure Rabbit Anti-Rat IgG (H+L) secondary antibody, DyLight488 Conjugated

Sign In for Pricing
View Details
AffiniPure Rabbit Anti-Rat IgG (H+L) secondary antibody, DyLight488 Conjugated
MBS1759568-03 5x 1 mL

AffiniPure Rabbit Anti-Rat IgG (H+L) secondary antibody, DyLight488 Conjugated

Sign In for Pricing
View Details