Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rabbit TFPI protein

This Rabbit TFPI protein spans the amino acid sequence from region 25-300a. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TFPI

UniProt

P19761

Expression Region

25-300a

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 25-300a

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human αFP (Alpha-Fetoprotein) ELISA Kit
EKE60067 96 Tests

Human αFP (Alpha-Fetoprotein) ELISA Kit

Sign In for Pricing
View Details
ATP6V1H (NM_015941) Human Over-expression Lysate
LC414295 20 µg

ATP6V1H (NM_015941) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat Muscarinic acetylcholine receptor M2, CHRM2 ELISA KIT
E1491Ra-01 48 Well

Rat Muscarinic acetylcholine receptor M2, CHRM2 ELISA KIT

Sign In for Pricing
View Details
Rat Muscarinic acetylcholine receptor M2, CHRM2 ELISA KIT
E1491Ra-02 96 Well

Rat Muscarinic acetylcholine receptor M2, CHRM2 ELISA KIT

Sign In for Pricing
View Details
Rat Muscarinic acetylcholine receptor M2, CHRM2 ELISA KIT
E1491Ra-03 5x 96 Tests

Rat Muscarinic acetylcholine receptor M2, CHRM2 ELISA KIT

Sign In for Pricing
View Details
Rat Muscarinic acetylcholine receptor M2, CHRM2 ELISA KIT
E1491Ra-04 10x 96 Tests

Rat Muscarinic acetylcholine receptor M2, CHRM2 ELISA KIT

Sign In for Pricing
View Details