Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RPL36AL protein

This Human RPL36AL protein spans the amino acid sequence from region 1-106aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RPL36AL

UniProt

Q969Q0

Expression Region

1-106aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse SH2 domain-containing adapter protein D (SHD) ELISA Kit
abx545723 96 Tests

Mouse SH2 domain-containing adapter protein D (SHD) ELISA Kit

Sign In for Pricing
View Details
Mcl-1 (B-6) Alexa Fluor® 594
sc-74436 AF594 200 µg/mL

Mcl-1 (B-6) Alexa Fluor® 594

Sign In for Pricing
View Details
Fnbp4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4778005 3x 1.0 µg

Fnbp4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
SNAP91 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
44503154 3x 1.0 µg DNA

SNAP91 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Adenovirus Amplification (10^9)
C070 2 x 1 mL of 109pfu/mL

Adenovirus Amplification (10^9)

Sign In for Pricing
View Details
CPT1B (NM_004377) Human Over-expression Lysate
E45H07175-2 20 µg

CPT1B (NM_004377) Human Over-expression Lysate

Sign In for Pricing
View Details