Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RPL36AL protein

This Human RPL36AL protein spans the amino acid sequence from region 1-106aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RPL36AL

UniProt

Q969Q0

Expression Region

1-106aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZDHHC2 Rabbit pAb
orb2711838-01 50 µL

ZDHHC2 Rabbit pAb

Sign In for Pricing
View Details
ZDHHC2 Rabbit pAb
orb2711838-02 100 µL

ZDHHC2 Rabbit pAb

Sign In for Pricing
View Details
Canine Aryl Hydrocarbon Receptor Repressor ELISA Kit
MBS106151-01 48 Well

Canine Aryl Hydrocarbon Receptor Repressor ELISA Kit

Sign In for Pricing
View Details
Canine Aryl Hydrocarbon Receptor Repressor ELISA Kit
MBS106151-02 96 Well

Canine Aryl Hydrocarbon Receptor Repressor ELISA Kit

Sign In for Pricing
View Details
Canine Aryl Hydrocarbon Receptor Repressor ELISA Kit
MBS106151-03 5x 96 Well

Canine Aryl Hydrocarbon Receptor Repressor ELISA Kit

Sign In for Pricing
View Details
Canine Aryl Hydrocarbon Receptor Repressor ELISA Kit
MBS106151-04 10x 96 Well

Canine Aryl Hydrocarbon Receptor Repressor ELISA Kit

Sign In for Pricing
View Details