Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TBX18 protein

This Human TBX18 protein spans the amino acid sequence from region 1-607aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TBX18

UniProt

O95935

Expression Region

1-607aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

80.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-607aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAEKRRGSPCSMLSLKAHAFSVEALIGAEKQQQLQKKRRKLGAEEAAGAVDDGGCSRGGGAGEKGSSEGDEGAALPPPAGATSGPARSGADLERGAAGGCEDGFQQGASPLASPGGSPKGSPARSLARPGTPLPSPQAPRVDLQGAELWKRFHEIGTEMIITKAGRRMFPAMRVKISGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSPASGETWMRQVISFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDCGDDLSPIKPVPSGEGVKAFSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGRNRMGLEALVESYAFWRPSLRTLTFEDIPGIPKQGNASSSTLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTFSCPQTSLSMQISGMSPQLQYIMPSPSSNAFATNQTHQGSYNTFRLHSPCALYGYNFSTSPKLAASPEKIVSSQGSFLGSSPSGTMTDRQMLPPVEGVHLLSSGGQQSFFDSRTLGSLTLSSSQVSAHMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIC8 (RIC8B) Human shRNA Plasmid Kit (Locus ID 55188)
TL301996 1 Kit

RIC8 (RIC8B) Human shRNA Plasmid Kit (Locus ID 55188)

Sign In for Pricing
View Details
CFL2 Conjugated Antibody
C46483 100 µL

CFL2 Conjugated Antibody

Sign In for Pricing
View Details
Tgfb2 (BC011055) Mouse Recombinant Protein
E45M47853M5 20 µg

Tgfb2 (BC011055) Mouse Recombinant Protein

Sign In for Pricing
View Details
C1orf129 Polyclonal Antibody, Cy5 Conjugated
bs-9778R-Cy5 100 µL

C1orf129 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
ANKRD12 sgRNA CRISPR Lentivector (Human) (Target 1)
K0088702 1.0 µg DNA

ANKRD12 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
HEG1 Antibody / Protein HEG homolog 1
V5781-20UG 20 µg

HEG1 Antibody / Protein HEG homolog 1

Sign In for Pricing
View Details