Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TBX18 protein

This Human TBX18 protein spans the amino acid sequence from region 1-607aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TBX18

UniProt

O95935

Expression Region

1-607aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

80.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-607aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAEKRRGSPCSMLSLKAHAFSVEALIGAEKQQQLQKKRRKLGAEEAAGAVDDGGCSRGGGAGEKGSSEGDEGAALPPPAGATSGPARSGADLERGAAGGCEDGFQQGASPLASPGGSPKGSPARSLARPGTPLPSPQAPRVDLQGAELWKRFHEIGTEMIITKAGRRMFPAMRVKISGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSPASGETWMRQVISFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDCGDDLSPIKPVPSGEGVKAFSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGRNRMGLEALVESYAFWRPSLRTLTFEDIPGIPKQGNASSSTLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTFSCPQTSLSMQISGMSPQLQYIMPSPSSNAFATNQTHQGSYNTFRLHSPCALYGYNFSTSPKLAASPEKIVSSQGSFLGSSPSGTMTDRQMLPPVEGVHLLSSGGQQSFFDSRTLGSLTLSSSQVSAHMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ddn Mouse siRNA Oligo Duplex (Locus ID 13199)
SR419403 1 Kit

Ddn Mouse siRNA Oligo Duplex (Locus ID 13199)

Sign In for Pricing
View Details
Recombinant Lactobacillus helveticus UPF0398 protein lhv_1265 (lhv_1265)
MBS1082056-01 0.02 mg (E-Coli)

Recombinant Lactobacillus helveticus UPF0398 protein lhv_1265 (lhv_1265)

Sign In for Pricing
View Details
Recombinant Lactobacillus helveticus UPF0398 protein lhv_1265 (lhv_1265)
MBS1082056-02 0.1 mg (E-Coli)

Recombinant Lactobacillus helveticus UPF0398 protein lhv_1265 (lhv_1265)

Sign In for Pricing
View Details
Recombinant Lactobacillus helveticus UPF0398 protein lhv_1265 (lhv_1265)
MBS1082056-03 0.02 mg (Yeast)

Recombinant Lactobacillus helveticus UPF0398 protein lhv_1265 (lhv_1265)

Sign In for Pricing
View Details
Recombinant Lactobacillus helveticus UPF0398 protein lhv_1265 (lhv_1265)
MBS1082056-04 0.1 mg (Yeast)

Recombinant Lactobacillus helveticus UPF0398 protein lhv_1265 (lhv_1265)

Sign In for Pricing
View Details
Recombinant Lactobacillus helveticus UPF0398 protein lhv_1265 (lhv_1265)
MBS1082056-05 0.02 mg (Baculovirus)

Recombinant Lactobacillus helveticus UPF0398 protein lhv_1265 (lhv_1265)

Sign In for Pricing
View Details