Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TBX18 protein

This Human TBX18 protein spans the amino acid sequence from region 1-607aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TBX18

UniProt

O95935

Expression Region

1-607aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

80.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-607aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAEKRRGSPCSMLSLKAHAFSVEALIGAEKQQQLQKKRRKLGAEEAAGAVDDGGCSRGGGAGEKGSSEGDEGAALPPPAGATSGPARSGADLERGAAGGCEDGFQQGASPLASPGGSPKGSPARSLARPGTPLPSPQAPRVDLQGAELWKRFHEIGTEMIITKAGRRMFPAMRVKISGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSPASGETWMRQVISFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDCGDDLSPIKPVPSGEGVKAFSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGRNRMGLEALVESYAFWRPSLRTLTFEDIPGIPKQGNASSSTLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTFSCPQTSLSMQISGMSPQLQYIMPSPSSNAFATNQTHQGSYNTFRLHSPCALYGYNFSTSPKLAASPEKIVSSQGSFLGSSPSGTMTDRQMLPPVEGVHLLSSGGQQSFFDSRTLGSLTLSSSQVSAHMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hdac6 Protein (N-GST, Canine)
P525257 100 µg

Hdac6 Protein (N-GST, Canine)

Sign In for Pricing
View Details
Rat Oma1 Pre-designed siRNA Set B
SI209775B 1 Each

Rat Oma1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
TUBAL3 Mouse Monoclonal Antibody [Clone 5F10]
E45M12022V-2 50 µL

TUBAL3 Mouse Monoclonal Antibody [Clone 5F10]

Sign In for Pricing
View Details
Snx3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4594607 1.0 µg DNA

Snx3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
MYT1, CT (Membrane-associated Tyrosine-and Threonine-specific cdc2-inhibitory Kinase, Myt1 Kinase, PKMYT1) (Azide free) (HRP)
MBS6489059-01 0.2 mL

MYT1, CT (Membrane-associated Tyrosine-and Threonine-specific cdc2-inhibitory Kinase, Myt1 Kinase, PKMYT1) (Azide free) (HRP)

Sign In for Pricing
View Details
MYT1, CT (Membrane-associated Tyrosine-and Threonine-specific cdc2-inhibitory Kinase, Myt1 Kinase, PKMYT1) (Azide free) (HRP)
MBS6489059-02 5x 0.2 mL

MYT1, CT (Membrane-associated Tyrosine-and Threonine-specific cdc2-inhibitory Kinase, Myt1 Kinase, PKMYT1) (Azide free) (HRP)

Sign In for Pricing
View Details