Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SUB1 protein

This Human SUB1 protein spans the amino acid sequence from region 2-127aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SUB1

UniProt

P53999

Expression Region

2-127aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 2-127aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFRSF11B Rabbit Polyclonal Antibody
E10G00586 100 µL

TNFRSF11B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MED20 Protein Vector (Mouse) (pPM-C-HA)
28304024 500 ng

MED20 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
N6amt1 Mouse siRNA Oligo Duplex (Locus ID 67768)
SR403095 1 Kit

N6amt1 Mouse siRNA Oligo Duplex (Locus ID 67768)

Sign In for Pricing
View Details
Rabbit Polyclonal RIG-I Antibody
NBP2-55599-25ul 25 µL

Rabbit Polyclonal RIG-I Antibody

Sign In for Pricing
View Details
ONECUT1 Antibody
orb2672436-01 50 µL

ONECUT1 Antibody

Sign In for Pricing
View Details
ONECUT1 Antibody
orb2672436-02 100 µL

ONECUT1 Antibody

Sign In for Pricing
View Details